PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00878g00327.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family MYB_related
Protein Properties Length: 653aa    MW: 73367.4 Da    PI: 9.9167
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00878g00327.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding26.31.7e-08437236
                              SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS- CS
           Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRt 36
                              + W+t+E++ll+ avk++G ++W++++ +++ +R 
  Peaxi162Scf00878g00327.1  4 KTWSTWEELLLAFAVKRHGLKDWESVSMELQ-NRI 37
                              57*****************************.774 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.423155IPR017877Myb-like domain
SMARTSM007177.2E-4257IPR001005SANT/Myb domain
PfamPF002495.9E-7437IPR001005SANT/Myb domain
SuperFamilySSF466893.04E-7479IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.7E-5556IPR009057Homeodomain-like
CDDcd001672.60E-5554No hitNo description
SMARTSM002971.1E-16284393IPR001487Bromodomain
SuperFamilySSF473707.98E-18292390IPR001487Bromodomain
Gene3DG3DSA:1.20.920.104.6E-16293395IPR001487Bromodomain
CDDcd043691.54E-15295388No hitNo description
PfamPF004391.1E-10299378IPR001487Bromodomain
PROSITE profilePS5001412.264303374IPR001487Bromodomain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 653 aa     Download sequence    Send to blast
MEEKTWSTWE ELLLAFAVKR HGLKDWESVS MELQNRITSS LFTPQICKDK YHHLRRRFIT  60
FHDDDEKING HDEIVGEDVT IPWIEELRQL RVAELKQEVQ RYDLSIQSLQ LKVKKMEEER  120
ELSLKEEGEK PDLDDVKEER SQNDKNSGAD AKPDDFTGKP VSSEDSDREN RSCNESNSTE  180
NKRTGLKNEP DLVKPVQEVV IIKPVSEEDS CNDSTSSDKH EGEKKIVASR DDSGDLRGDD  240
SVSESKEVGT KESSDVQSTA SLSKRKKRSS GGGDAAEMGS PAIGIIIKTA KSEPLIEFLD  300
IIRSHKRGSV FKRRLDSQKT DKYKNMIRQH MDLEMVQARI DEGSYCSCPA KFYLDLLLIF  360
NNAIVYFPKS SPESTAANEL RGIVMEEYKK NRTQSKDQSP GPEPGPVPVM IQPKPELERS  420
DSLLAKHKST APIVVCRKRS SISAKAAASG NNSKPEKQAD IKPPLNPKPP IKSSSNEEDS  480
SIKVGIKEKP VTGVRSMRRS SKGRPTNVSQ SNTNQNTNIK QTTSSNTEKK EDAKPEKKKE  540
EAKKRGAAAD FLKRIKKNSP TKGTLMEALK NPTEEVVVKG NKREPQKKKV DERRETPVRR  600
GGGGGGSKEE GSPSKRGRPP KRGGRETAQE KRVRENSEKQ DDSAKRPKKR SRR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1644652KRPKKRSRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009602840.10.0PREDICTED: bromodomain-containing protein DDB_G0270170
TrEMBLM1A7730.0M1A773_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000161550.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA42682136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G44430.14e-76DNA-binding bromodomain-containing protein